PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00103373001
Common NameGSBRNA2T00103373001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 241aa    MW: 27265.3 Da    PI: 10.1882
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00103373001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.15.2e-323590258
            CBFB_NFYA  2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                         e ++VNaKQy++I++RRq+Rakle+++kl +k+rkpylheSRh hAl+RpRgsgGrF
  GSBRNA2T00103373001 35 ESVFVNAKQYHAIMRRRQQRAKLEAQNKL-IKARKPYLHESRHVHALKRPRGSGGRF 90
                         789**************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.6E-373293IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.7593393IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.7E-233658IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.8E-263690IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068603858IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.7E-236790IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MRFQVSSSIL QTCNPQMVGM VPGRVALPVE ITETESVFVN AKQYHAIMRR RQQRAKLEAQ  60
NKLIKARKPY LHESRHVHAL KRPRGSGGRF LNTKKLLQES QQAAAKEQER DKSVQQAMRQ  120
TCLDSKLICC STTKTVVAQP LLALTSHLFP KVLISSEKLN SSFRVSQQLR LTELCLFMVS  180
PMTCMEVGTC TISLSISETL DLWCCFMFPT KRGSHPWLLL LLVLLLAVTC YFSISLYLLF  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A7e-213595363NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.133091e-174seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00103373001
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895070.0AC189507.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB088E11, complete sequence.
GenBankAC1896070.0AC189607.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH031P22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A078C7V41e-177A0A078C7V4_BRANA; BnaC06g33950D protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33492762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.13e-53nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]